Neuer Bezirk Zhuqiao Pudong Straße No.8 Jinshun, Shanghai, China
Startseite ProdukteInjizierbare Peptide

Muskel-Gebäude-Peptide CJC-1295 ohne DAC für Bodybuilder

Muskel-Gebäude-Peptide CJC-1295 ohne DAC für Bodybuilder

    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
  • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders

    Produktdetails:

    Herkunftsort: Shanghai
    Markenname: FILTER
    Zertifizierung: GMP
    Modellnummer: API

    Zahlung und Versand AGB:

    Min Bestellmenge: 10 Phiolen
    Preis: USD 4~8 per vial
    Verpackung Informationen: 2mg, 5mg/vial, 10mg/vial oder wie erforderlich
    Lieferzeit: Innerhalb von 3 Werktagen
    Zahlungsbedingungen: L/C, T/T, , MoneyGram, Payneer
    Versorgungsmaterial-Fähigkeit: 100,000VIALS/MONTH
    Kontakt
    Ausführliche Produkt-Beschreibung
    Spezifikation: 2mg/vial Aussehen: weißes Pulver
    DeliveryTime: innerhalb 3~7 Werktage Port: Shanghai/Shenzhen Hong Kong
    Verpackung: Icebag, diskrete Verpackungsweisen als Ihre Referenz LimitNum: 10 Phiolen
    Reinheit: 99% Transport: DHL, Fedix, HKEMS, HKEUB, TNT
    Storage: trockener, dunkler und gelüfteter Platz, (dogree 2~8)
    Markieren:

    peptides bodybuilding supplements

    ,

    human growth peptides

    CJC-1295 mit DAC

    Produkt-Name: CJC1295 DAC; CJC1295 mit DAC
    Alias: CJC1295 (GHRH/DAC)
    Reihenfolge: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-LysLys (Maleimidopropionyl) - NH2 (Affinitäts-Komplex)
    Dichte: 1,45
    CJC-1295 mit DAC
    Art: Immunfunktion AgentsGrade
    Standard: Medizin-Grad
    Klassifikation: Brassinosteroid
    MF: C165H271N47O46
    Molekulargewicht: 3649,30
    Reinheit (HPLC): 98,0%
    Auftritt: Weißes Pulver
    Einzelne Verunreinigung (HPLC): 1,0%
    Aminosäurestruktur: 10% von theoretischem
    Peptid-Gehalt (N%): 80% (durch %N)
    Wassergehalt (Karl Fischer): 6,0%
    Azetat-Gehalt (HPIC): 15,0%
    Ausgleichsmasse: 95.0~105.0%

    Filter Biotech Co., Ltd. Business Field:

    Als Peptide und Steroide Hersteller, sind wir für Soem für Kunden, die Marken-Anforderungen haben. (Service nach Maß).
    Unsere Firmendienstleistungen:

    1. Pharmazeutisches Peptide+Bodubuilding-Peptid
    2. Kosmetisches Peptid
    3. Pulver, Öl und Vorsprünge Sterodis
    4. Service nach Maß

    Welches schreibt Ihre Kunden bevorzugen?

     

    Beschreibung
    Produkt-Name: CJC1295
    Synonyme: CJC1295; Y (d - A) DAIFTQSYRKVLAQLSARKLLQDILSR-NH2; L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6- [3 (2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl) - 1-oxopropyl] - L-lysinamide; Azetat CJC-1295; CJC1295 mit heraus DAC
    CAS: 863288-34-0
    MF: C159H258N46O45
    MW: 0
    EINECS:  
    Produkt-Kategorien: Peptide


    Unser Prozess:
    Der Qualitätskontrollprozeß
    1) Kauf
    Gründliche Marktforschung, verstehen den Preis von Rohstoffen und von Leistung. Zur Beschaffungsquelle, zum völlig zu verstehen und der Qualität der Beschaffung von Rohstoffen völlig zu garantieren.


    2) Inspektion
    Vier Schritte: Probenahme, Beispielvorbehandlung, Messen und Datenverarbeitung.


    3) Produzieren
    A), muss jeder Betreiber Selbstkontrolle von producs tun und die entsprechenden Prüfprotokolle machen.
    B), überprüfen Vollzeitinspektoren durch die Betreiberselbstkontrolle und Bericht und unterzeichnen herein die entsprechende Aufzeichnung. Vollzeitinspektion ist für Inspektion des Endprodukts verantwortlich und macht das Endprodukt ankommende Prüfprotokolle.


    4) Vor dem Verkauf
    Vor dem Verkauf Testergebnis kann zur Verfügung gestellt werden.
    Aus dritter Quelleentdeckungsinstitution wird erlaubt, wenn Sie nicht mit Testergebnissen zufrieden sind.


    Unsere Vorteile:
    1. Qualität:
    Unsere Firma ist eine Berufsproduktion von Hormonvermittlern jahrelang, haben unsere Produkte nach Deutschland, Spanien, Großbritannien, USA, Australien, Mittlere Osten, und so weiter anderes Land exportiert, und wir haben sehr gutes Feedback von unseren Kunden, Sie können uns vertrauen.
    Und wir sind die Manufaktur, so kein Problem, damit wir die Qualität steuern.
    2. Zahlungsmethode: , TT.
    3. Service: Bester Service mit Kundendienst zu allen Kunden.
    4. Lieferung:
    Beispielauftrag: Paket wird mit 3days nach Zahlung versendet. Wir können es über OBEN senden, EMS, HK zur Sprache bringen Posten, DHL oder othermethod. Wir haben eine Berufs- und stabile Logistik, und wir können das Paket herum 3 bis 5 Tage glatt liefern.


    Anderes Peptid unsere Laborversorgung:

    Produkt Reinheit CAS nein.
    Glucagon-Hydrochlorid 98% 16941-32-5
    Gonadorelin-Azetat 98% 34973-08-5
    Goserelin-Azetat 98% 145781-92-6
    (Menschliches) Azetat GRF 98% 83930-13-6
    Hexarelin-Azetat 98% 140703-51-1
    Histrelin-Azetat 98% 76712-82-8
    Icatibant-Azetat 98% 30308-48-4
    Lanreotide 98% 108736-35-2
    Azetat Lecirelin (Dalmarelin) 98% 61012-19-9
    Leuprolide 98% 74381-53-6
    Leuprorelin-Azetat 98% 53714-56-0
    Linaclotide Acatate 98% 851199-59-2
    Lixisenatide 98% 320367-13-3
    Lraglutide 98% 204656-20-2
    Lysipressin-Azetat 98% 50-57-7
    Azetat Melanotan II 98% 121062-08-6
    MOG (35-55) 98% 163913-87-9
    Nafarelin-Azetat 98% 76932-56-4
    Nesiritide-Azetat (BNP-32) 98% 114471-18-0
    Octreotid 98% 79517-01-4
    Ornipressin-Azetat 98% 3397-23-7
    Oxytocin-Azetat 98% 50-56-6
    Palmitoyl Pentapeptide 98% 214047-00-4
    Pexiganan 98% 147664-63-9
    Pramlintide-Azetat 98% 196078-30-5
    Pretirelin    
    Azetat PT141 98% 32780-32-8
    Lachscalcitonin-Azetat 98% 47931-85-1
    Secretin-Azetat 98% 10813-74-8
    Sermorelin-Azetat 98% 86168-78-7
    Sincalide 98% 25126-32-3
    Somatostatin-Azetat 98% 38916-34-6
    Splenopentin-Azetat 98% 105184-37-0
    Taltirelin-Azetat 98% 103300-74-9
    Teriparatide-Azetat 98% 52232-67-4
    Teriparatide-Azetat 98% 52232-67-4
    Terlipressin-Azetat 98% 14636-12-5
    Tetracosactide-Azetat 98% 16960-16-0
    Thymalfasin 98% 62304-98-7
    Thymopentin 98% 69558-55-0
    Azetat Thymosin α1 98% 14636-12-5
    Azetat Thymosin β4 (TB-500) 98% 77591-33-4
    Triptorelin-Azetat 98% 57773-63-4
    Vapreotide-Azetat 98% 103222-11-3
    Vasopressin-Azetat 98% 9034-50-8
    Ziconotid-Azetat 98% 107452-89-1

     

    Labor

    Muskel-Gebäude-Peptide CJC-1295 ohne DAC für Bodybuilder 0

    Promi Kunden-Politik:
    Wenn Ihre Kaufgesamtmenge in unserer Firma pro Jahr 50.000 USD, am Jahresende erreichen könnte, könnten wir 2%-5% der Gesamtmenge verwenden, um zollfreie Waren zu senden.

    Kunden-Arten, die mehr Unterstützung hatten:
    Kunde 1.Potenzial
    (Mit Markt-Kunden-Zahl der Anschaffungsdaten-+Clients gegenwärtiger und Produkt-Quantität pro den Monat zum zuzutreffen)

    Gruppe des Kunden 2.Stable und stabiler Quantitäts-Auftrag pro Monat
    (Mit kompletten Anschaffungsdaten mit unserer Firma zum zuzutreffen)

    persönliche Benutzer 3.Regular
    (Mit kompletten Anschaffungsdaten mit unserer Firma zum zuzutreffen)

    4.Clients, die Kapitalien haben und den Plan haben, zum des Marktes zu erweitern
    (Mit Markt-Kunden-Zahl der Anschaffungsdaten-+Clients gegenwärtiger und Produkt-Quantität pro den Monat zum zuzutreffen)
    ** Gegenwärtiger wirklicher Data+Future-Markt (basiert auf Strom)
     

    Kontaktdaten
    Passion Technology Development Limited

    Ansprechpartner: Qin

    Senden Sie Ihre Anfrage direkt an uns (0 / 3000)

    Andere Produkte
    Referenzen

    E-Mail | Sitemap

    Privacy Policy China Gut Qualität Injizierbare Peptide Fournisseur. © 2018 - 2021 peptide-steroids.com. All Rights Reserved.